| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins) |
| Protein Fatty oxidation complex alpha subunit, C-terminal domain [109949] (1 species) duplication: contains two repeats of this domain |
| Species Pseudomonas fragi [TaxId:296] [109950] (4 PDB entries) Uniprot P28793 |
| Domain d1wdlb2: 1wdl B:621-715 [109267] Other proteins in same PDB: d1wdla3, d1wdla4, d1wdlb3, d1wdlb4, d1wdlc1, d1wdlc2, d1wdld1, d1wdld2 complexed with aco, n8e, nad |
PDB Entry: 1wdl (more details), 3.5 Å
SCOPe Domain Sequences for d1wdlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdlb2 a.100.1.3 (B:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]}
dvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrggalryidsigv
aefvaladqyaelgalyhptaklremakngqsffg
Timeline for d1wdlb2: