Lineage for d1wdla4 (1wdl A:1-310)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480393Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 480394Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 480448Family c.14.1.3: Crotonase-like [52103] (8 proteins)
  6. 480527Protein Fatty oxidation complex alpha subunit, N-terminal domain [110450] (1 species)
  7. 480528Species Pseudomonas fragi [TaxId:296] [110451] (3 PDB entries)
  8. 480531Domain d1wdla4: 1wdl A:1-310 [109265]
    Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla3, d1wdlb1, d1wdlb2, d1wdlb3, d1wdlc1, d1wdlc2, d1wdld1, d1wdld2

Details for d1wdla4

PDB Entry: 1wdl (more details), 3.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)

SCOP Domain Sequences for d1wdla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdla4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi}
miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
kkkakvydki

SCOP Domain Coordinates for d1wdla4:

Click to download the PDB-style file with coordinates for d1wdla4.
(The format of our PDB-style files is described here.)

Timeline for d1wdla4: