![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
![]() | Protein Fatty oxidation complex alpha subunit, N-terminal domain [110450] (1 species) |
![]() | Species Pseudomonas fragi [TaxId:296] [110451] (4 PDB entries) Uniprot P28793 |
![]() | Domain d1wdla4: 1wdl A:1-310 [109265] Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla3, d1wdlb1, d1wdlb2, d1wdlb3, d1wdlc1, d1wdlc2, d1wdld1, d1wdld2 complexed with aco, n8e, nad |
PDB Entry: 1wdl (more details), 3.5 Å
SCOPe Domain Sequences for d1wdla4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdla4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel kkkakvydki
Timeline for d1wdla4: