![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain [419022] (1 species) |
![]() | Species Pseudomonas fragi [TaxId:296] [419504] (4 PDB entries) Uniprot P28790 |
![]() | Domain d1wdkd1: 1wdk D:2-263 [109260] Other proteins in same PDB: d1wdka1, d1wdka2, d1wdka3, d1wdka4, d1wdkb1, d1wdkb2, d1wdkb3, d1wdkb4, d1wdkc2, d1wdkd2 complexed with aco, hg, n8e, nad, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wdk (more details), 2.5 Å
SCOPe Domain Sequences for d1wdkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdkd1 c.95.1.1 (D:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain {Pseudomonas fragi [TaxId: 296]} slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt ssqitdgascmivmsaqrakdl
Timeline for d1wdkd1: