Lineage for d1wdkd1 (1wdk D:2-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916884Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain [419022] (1 species)
  7. 2916885Species Pseudomonas fragi [TaxId:296] [419504] (4 PDB entries)
    Uniprot P28790
  8. 2916887Domain d1wdkd1: 1wdk D:2-263 [109260]
    Other proteins in same PDB: d1wdka1, d1wdka2, d1wdka3, d1wdka4, d1wdkb1, d1wdkb2, d1wdkb3, d1wdkb4, d1wdkc2, d1wdkd2
    complexed with aco, hg, n8e, nad, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1wdkd1

PDB Entry: 1wdk (more details), 2.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native2)
PDB Compounds: (D:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d1wdkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdkd1 c.95.1.1 (D:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain {Pseudomonas fragi [TaxId: 296]}
slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
ssqitdgascmivmsaqrakdl

SCOPe Domain Coordinates for d1wdkd1:

Click to download the PDB-style file with coordinates for d1wdkd1.
(The format of our PDB-style files is described here.)

Timeline for d1wdkd1: