![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Domain d1wdkc2: 1wdk C:264-391 [109259] Other proteins in same PDB: d1wdka1, d1wdka2, d1wdka3, d1wdka4, d1wdkb1, d1wdkb2, d1wdkb3, d1wdkb4, d1wdkc1, d1wdkd1 complexed with aco, hg, n8e, nad, zn |
PDB Entry: 1wdk (more details), 2.5 Å
SCOPe Domain Sequences for d1wdkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), C-terminal domain {Pseudomonas fragi [TaxId: 296]} gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg iatvferv
Timeline for d1wdkc2: