Lineage for d1wdka4 (1wdk A:1-310)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690872Protein Fatty oxidation complex alpha subunit, N-terminal domain [110450] (1 species)
  7. 690873Species Pseudomonas fragi [TaxId:296] [110451] (4 PDB entries)
  8. 690874Domain d1wdka4: 1wdk A:1-310 [109253]
    Other proteins in same PDB: d1wdka1, d1wdka2, d1wdka3, d1wdkb1, d1wdkb2, d1wdkb3, d1wdkc1, d1wdkc2, d1wdkd1, d1wdkd2

Details for d1wdka4

PDB Entry: 1wdk (more details), 2.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native2)
PDB Compounds: (A:) Fatty oxidation complex alpha subunit

SCOP Domain Sequences for d1wdka4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}
miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
kkkakvydki

SCOP Domain Coordinates for d1wdka4:

Click to download the PDB-style file with coordinates for d1wdka4.
(The format of our PDB-style files is described here.)

Timeline for d1wdka4: