Lineage for d1wdka2 (1wdk A:621-715)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446391Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 446392Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 446429Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 446430Protein Fatty oxidation complex alpha subunit, C-terminal domain [109949] (1 species)
    duplication: contains two repeats of this domain
  7. 446431Species Pseudomonas fragi [TaxId:296] [109950] (3 PDB entries)
  8. 446433Domain d1wdka2: 1wdk A:621-715 [109251]
    Other proteins in same PDB: d1wdka3, d1wdka4, d1wdkb3, d1wdkb4, d1wdkc1, d1wdkc2, d1wdkd1, d1wdkd2

Details for d1wdka2

PDB Entry: 1wdk (more details), 2.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native2)

SCOP Domain Sequences for d1wdka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdka2 a.100.1.3 (A:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi}
dvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrggalryidsigv
aefvaladqyaelgalyhptaklremakngqsffg

SCOP Domain Coordinates for d1wdka2:

Click to download the PDB-style file with coordinates for d1wdka2.
(The format of our PDB-style files is described here.)

Timeline for d1wdka2: