Lineage for d1wdgb_ (1wdg B:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525919Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 526127Superfamily h.3.3: Coronavirus S2 glycoprotein (Pfam 01601) [111474] (1 family) (S)
  5. 526128Family h.3.3.1: Coronavirus S2 glycoprotein (Pfam 01601) [111475] (1 protein)
  6. 526129Protein E2 spike glycoprotein [111476] (2 species)
  7. 526137Species Murine hepatitis virus, MHV [TaxId:11138] [111477] (2 PDB entries)
  8. 526139Domain d1wdgb_: 1wdg B: [109249]

Details for d1wdgb_

PDB Entry: 1wdg (more details), 2.06 Å

PDB Description: crystal structure of mhv spike protein fusion core

SCOP Domain Sequences for d1wdgb_:

Sequence, based on SEQRES records: (download)

>d1wdgb_ h.3.3.1 (B:) E2 spike glycoprotein {Murine hepatitis virus, MHV}
qkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlslvprgsggsggs
gglnvtlldltyemnriqdaikklnesyinlke

Sequence, based on observed residues (ATOM records): (download)

>d1wdgb_ h.3.3.1 (B:) E2 spike glycoprotein {Murine hepatitis virus, MHV}
qkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsldltyemnriqd
aikklnesyinlke

SCOP Domain Coordinates for d1wdgb_:

Click to download the PDB-style file with coordinates for d1wdgb_.
(The format of our PDB-style files is described here.)

Timeline for d1wdgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wdga_