SCOP 1.69: Domain d1wdga_: 1wdg A:

Lineage for d1wdga_ (1wdg A:)

1. Root: SCOP 1.69

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein (Pfam 01601) [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein (Pfam 01601) [111475] (1 protein)

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Murine hepatitis virus, MHV [TaxId:11138] [111477] (2 PDB entries)

8. Domain d1wdga_: 1wdg A: [109248]

Details for d1wdga_

PDB Entry: 1wdg, 2.06 Å

PDB Description: crystal structure of mhv spike protein fusion core

SCOP Domain Sequences for d1wdga_:

Sequence, based on SEQRES records:

>d1wdga_ h.3.3.1 (A:) E2 spike glycoprotein {Murine hepatitis virus, MHV}
nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlslvprgsggsgg
sgglnvtlldltyemnriqdaikklnesyinlke

Sequence, based on observed residues (ATOM records):

>d1wdga_ h.3.3.1 (A:) E2 spike glycoprotein {Murine hepatitis virus, MHV}
nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsllnvtlldlty
emnriqdaikklnesyinlke

Timeline for d1wdga_:

• d1wdga_ is new in SCOP 1.69
  
• d1wdga_ appears in SCOP 1.71
  
• d1wdga_ appears in the current release, SCOPe 2.08