Lineage for d1wdga_ (1wdg A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042207Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (2 families) (S)
  5. 3042208Family h.3.3.1: Coronavirus spike glycoprotein S2 fragments [111475] (1 protein)
  6. 3042209Protein E2 spike glycoprotein [111476] (2 species)
  7. 3042238Species Murine hepatitis virus, MHV [TaxId:11138] [111477] (2 PDB entries)
    Uniprot P11224 969-1024,1224-1254
  8. 3042239Domain d1wdga_: 1wdg A: [109248]

Details for d1wdga_

PDB Entry: 1wdg (more details), 2.06 Å

PDB Description: crystal structure of mhv spike protein fusion core
PDB Compounds: (A:) e2 glycoprotein

SCOPe Domain Sequences for d1wdga_:

Sequence, based on SEQRES records: (download)

>d1wdga_ h.3.3.1 (A:) E2 spike glycoprotein {Murine hepatitis virus, MHV [TaxId: 11138]}
nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlslvprgsggsgg
sgglnvtlldltyemnriqdaikklnesyinlke

Sequence, based on observed residues (ATOM records): (download)

>d1wdga_ h.3.3.1 (A:) E2 spike glycoprotein {Murine hepatitis virus, MHV [TaxId: 11138]}
nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsllnvtlldlty
emnriqdaikklnesyinlke

SCOPe Domain Coordinates for d1wdga_:

Click to download the PDB-style file with coordinates for d1wdga_.
(The format of our PDB-style files is described here.)

Timeline for d1wdga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wdgb_