SCOPe 2.07: Domain d1wdfa_: 1wdf A:

Lineage for d1wdfa_ (1wdf A:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
   Pfam PF01601

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Murine hepatitis virus, MHV [TaxId:11138] [111477] (2 PDB entries)
   Uniprot P11224 969-1024,1224-1254

8. Domain d1wdfa_: 1wdf A: [109246]

Details for d1wdfa_

PDB Entry: 1wdf, 2.5 Å

PDB Description: crystal structure of mhv spike protein fusion core

PDB Compounds: (A:) e2 glycoprotein

SCOPe Domain Sequences for d1wdfa_:

Sequence, based on SEQRES records:

>d1wdfa_ h.3.3.1 (A:) E2 spike glycoprotein {Murine hepatitis virus, MHV [TaxId: 11138]}
qkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsnrfgaisdlsld
feklnvtlldltyemnriqdaikklnesyinl

Sequence, based on observed residues (ATOM records):

>d1wdfa_ h.3.3.1 (A:) E2 spike glycoprotein {Murine hepatitis virus, MHV [TaxId: 11138]}
qkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsnrfgaidlsldf
eklnvtlldltyemnriqdaikklnesyinl

Timeline for d1wdfa_:

• d1wdfa_ first appeared in SCOP 1.69
  
• d1wdfa_ appears in SCOPe 2.06
  
• d1wdfa_ appears in the current release, SCOPe 2.08