SCOP 1.75: Domain d1wdaa3: 1wda A:294-663

Lineage for d1wdaa3 (1wda A:294-663)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (7 families)

5. Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein)
   # functionally related to the amidinotransferase, similar active sites

6. Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111154] (7 PDB entries)
   Uniprot Q9UM07

8. Domain d1wdaa3: 1wda A:294-663 [109245]
   Other proteins in same PDB: d1wdaa1, d1wdaa2
   complexed with bag, ca, so4; mutant

Details for d1wdaa3

PDB Entry: 1wda, 2.3 Å

PDB Description: crystal structure of human peptidylarginine deiminase type4 (pad4) in complex with benzoyl-l-arginine amide

PDB Compounds: (A:) Protein-arginine deiminase type IV

SCOP Domain Sequences for d1wdaa3:

Sequence; same for both SEQRES and ATOM records:

>d1wdaa3 d.126.1.5 (A:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp
fsfkwwnmvp

Timeline for d1wdaa3:

• d1wdaa3 first appeared in SCOP 1.69
  
• d1wdaa3 appears in SCOP 1.73
  
• d1wdaa3 appears in SCOPe 2.01
  
• d1wdaa3 appears in the current release, SCOPe 2.08