![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.6: Peptidylarginine deiminase Pad4, N-terminal domain [110107] (1 protein) probably related to cupredoxins but lacking the metal-binding site |
![]() | Protein Peptidylarginine deiminase Pad4, N-terminal domain [110108] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110109] (7 PDB entries) |
![]() | Domain d1wd9a2: 1wd9 A:4-112 [109241] Other proteins in same PDB: d1wd9a1, d1wd9a3 complexed with ca, so4; mutant |
PDB Entry: 1wd9 (more details), 2.6 Å
SCOP Domain Sequences for d1wd9a2:
Sequence, based on SEQRES records: (download)
>d1wd9a2 b.6.1.6 (A:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahsppakkkst gsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta
>d1wd9a2 b.6.1.6 (A:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gtlirvtpeqpthavcvlgtltqldicssasfsinaspgvvvdiawpldpgvevtltmka asgstgdqkvqisyyktppvkallylta
Timeline for d1wd9a2: