Lineage for d1wd9a1 (1wd9 A:113-293)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2378329Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. 2378330Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)
  6. 2378331Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)
  7. 2378332Species Human (Homo sapiens) [TaxId:9606] [110086] (17 PDB entries)
    Uniprot Q9UM07
  8. 2378340Domain d1wd9a1: 1wd9 A:113-293 [109240]
    Other proteins in same PDB: d1wd9a2, d1wd9a3
    complexed with ca, so4

Details for d1wd9a1

PDB Entry: 1wd9 (more details), 2.6 Å

PDB Description: calcium bound form of human peptidylarginine deiminase type4 (pad4)
PDB Compounds: (A:) Protein-arginine deiminase type IV

SCOPe Domain Sequences for d1wd9a1:

Sequence, based on SEQRES records: (download)

>d1wd9a1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records): (download)

>d1wd9a1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdmslm
tlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmdfy
vealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

SCOPe Domain Coordinates for d1wd9a1:

Click to download the PDB-style file with coordinates for d1wd9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wd9a1: