Lineage for d1wd4a2 (1wd4 A:338-499)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2402468Superfamily b.42.8: AbfB domain [110221] (2 families) (S)
    automatically mapped to Pfam PF05270
  5. 2402469Family b.42.8.1: AbfB domain [110222] (1 protein)
    Pfam PF05270
  6. 2402470Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species)
  7. 2402471Species Aspergillus kawachii [TaxId:40384] [110224] (2 PDB entries)
    Uniprot Q8NK89 19-499
  8. 2402473Domain d1wd4a2: 1wd4 A:338-499 [109236]
    Other proteins in same PDB: d1wd4a1
    complexed with ahr

Details for d1wd4a2

PDB Entry: 1wd4 (more details), 2.07 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinose
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d1wd4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd4a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachii [TaxId: 40384]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

SCOPe Domain Coordinates for d1wd4a2:

Click to download the PDB-style file with coordinates for d1wd4a2.
(The format of our PDB-style files is described here.)

Timeline for d1wd4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wd4a1