SCOP 1.71: Domain d1wd4a2: 1wd4 A:338-499

Lineage for d1wd4a2 (1wd4 A:338-499)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.8: AbfB domain [110221] (1 family)

5. Family b.42.8.1: AbfB domain [110222] (1 protein)
   Pfam 05270

6. Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species)

7. Species Aspergillus kawachi [110224] (2 PDB entries)

8. Domain d1wd4a2: 1wd4 A:338-499 [109236]
   Other proteins in same PDB: d1wd4a1
   complexed with ahr, nag

Details for d1wd4a2

PDB Entry: 1wd4, 2.07 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinose

SCOP Domain Sequences for d1wd4a2:

Sequence; same for both SEQRES and ATOM records:

>d1wd4a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachi}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

Timeline for d1wd4a2:

• d1wd4a2 first appeared in SCOP 1.69
  
• d1wd4a2 appears in SCOP 1.73
  
• d1wd4a2 appears in the current release, SCOPe 2.08