![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.8: AbfB domain (Pfam 05270) [110221] (1 family) ![]() |
![]() | Family b.42.8.1: AbfB domain (Pfam 05270) [110222] (1 protein) |
![]() | Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species) |
![]() | Species Aspergillus kawachi [110224] (2 PDB entries) |
![]() | Domain d1wd4a2: 1wd4 A:338-499 [109236] Other proteins in same PDB: d1wd4a1 |
PDB Entry: 1wd4 (more details), 2.07 Å
SCOP Domain Sequences for d1wd4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd4a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachi} lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas
Timeline for d1wd4a2: