Lineage for d1wd4a1 (1wd4 A:19-337)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556783Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (1 protein)
  6. 556784Protein Alpha-L-arabinofuranosidase B, N-terminal domain [110144] (1 species)
  7. 556785Species Aspergillus kawachi [110145] (2 PDB entries)
  8. 556787Domain d1wd4a1: 1wd4 A:19-337 [109235]
    Other proteins in same PDB: d1wd4a2
    complexed with ahr, nag

Details for d1wd4a1

PDB Entry: 1wd4 (more details), 2.07 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinose

SCOP Domain Sequences for d1wd4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd4a1 b.29.1.21 (A:19-337) Alpha-L-arabinofuranosidase B, N-terminal domain {Aspergillus kawachi}
gpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaqd
tfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkaygv
fmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmeai
ylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwair
ganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgypsd
dtensvqenivaakyvvgs

SCOP Domain Coordinates for d1wd4a1:

Click to download the PDB-style file with coordinates for d1wd4a1.
(The format of our PDB-style files is described here.)

Timeline for d1wd4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wd4a2