Lineage for d1wd3a2 (1wd3 A:338-499)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560958Superfamily b.42.8: AbfB domain [110221] (1 family) (S)
  5. 560959Family b.42.8.1: AbfB domain [110222] (1 protein)
    Pfam 05270
  6. 560960Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species)
  7. 560961Species Aspergillus kawachi [110224] (2 PDB entries)
  8. 560962Domain d1wd3a2: 1wd3 A:338-499 [109234]
    Other proteins in same PDB: d1wd3a1
    complexed with nag

Details for d1wd3a2

PDB Entry: 1wd3 (more details), 1.75 Å

PDB Description: crystal structure of arabinofuranosidase

SCOP Domain Sequences for d1wd3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd3a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachi}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

SCOP Domain Coordinates for d1wd3a2:

Click to download the PDB-style file with coordinates for d1wd3a2.
(The format of our PDB-style files is described here.)

Timeline for d1wd3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wd3a1