Lineage for d1wd3a2 (1wd3 A:338-499)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.8: AbfB domain [110221] (1 family) 
Family b.42.8.1: AbfB domain [110222] (1 protein)
Pfam 05270Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species) Species Aspergillus kawachi [110224] (2 PDB entries) 
Domain d1wd3a2: 1wd3 A:338-499 [109234]
Other proteins in same PDB: d1wd3a1
complexed with nag
Details for d1wd3a2
PDB Entry: 1wd3 (more details), 1.75 Å
PDB Description: crystal structure of arabinofuranosidase
SCOP Domain Sequences for d1wd3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd3a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachi}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas
SCOP Domain Coordinates for d1wd3a2:
Click to download the PDB-style file with coordinates for d1wd3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wd3a2:
- d1wd3a2 first appeared in SCOP 1.69
- d1wd3a2 appears in SCOP 1.73
- d1wd3a2 appears in the current release, SCOPe 2.08
View in 3D