Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.8: AbfB domain [110221] (2 families) automatically mapped to Pfam PF05270 |
Family b.42.8.1: AbfB domain [110222] (1 protein) Pfam PF05270 |
Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species) |
Species Aspergillus kawachii [TaxId:40384] [110224] (2 PDB entries) Uniprot Q8NK89 19-499 |
Domain d1wd3a2: 1wd3 A:338-499 [109234] Other proteins in same PDB: d1wd3a1 |
PDB Entry: 1wd3 (more details), 1.75 Å
SCOPe Domain Sequences for d1wd3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd3a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachii [TaxId: 40384]} lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas
Timeline for d1wd3a2: