SCOPe 2.08: Domain d1wd3a2: 1wd3 A:338-499

Lineage for d1wd3a2 (1wd3 A:338-499)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.8: AbfB domain [110221] (2 families)
   automatically mapped to Pfam PF05270

5. Family b.42.8.1: AbfB domain [110222] (1 protein)
   Pfam PF05270

6. Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species)

7. Species Aspergillus kawachii [TaxId:40384] [110224] (2 PDB entries)
   Uniprot Q8NK89 19-499

8. Domain d1wd3a2: 1wd3 A:338-499 [109234]
   Other proteins in same PDB: d1wd3a1

Details for d1wd3a2

PDB Entry: 1wd3, 1.75 Å

PDB Description: crystal structure of arabinofuranosidase

PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d1wd3a2:

Sequence; same for both SEQRES and ATOM records:

>d1wd3a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachii [TaxId: 40384]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

Timeline for d1wd3a2:

• d1wd3a2 first appeared in SCOP 1.69
  
• d1wd3a2 appears in SCOPe 2.07