Lineage for d1wd1a_ (1wd1 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665974Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 665975Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 665976Protein DNA-binding protein [54162] (2 species)
  7. 665977Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (9 PDB entries)
  8. 665984Domain d1wd1a_: 1wd1 A: [109231]

Details for d1wd1a_

PDB Entry: 1wd1 (more details), 2.2 Å

PDB Description: Crystal structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers
PDB Compounds: (A:) DNA-binding proteins 7a/7b/7d

SCOP Domain Sequences for d1wd1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd1a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]}
vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara
erek

SCOP Domain Coordinates for d1wd1a_:

Click to download the PDB-style file with coordinates for d1wd1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wd1a_: