Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins) |
Protein V8 protease [101809] (1 species) glutamic acid-specific protease |
Species Staphylococcus aureus [TaxId:1280] [101810] (2 PDB entries) |
Domain d1wcza_: 1wcz A: [109229] |
PDB Entry: 1wcz (more details), 2 Å
SCOP Domain Sequences for d1wcza_:
Sequence, based on SEQRES records: (download)
>d1wcza_ b.47.1.1 (A:) V8 protease {Staphylococcus aureus} vilpnndrhqitdttnghyapvtyiqveaptgtfiasgvvvgkdtlltnkhvvdathgdp halkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnn aetqvnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknev igihwggvpnefngavfinenvrnflkqniedinfa
>d1wcza_ b.47.1.1 (A:) V8 protease {Staphylococcus aureus} vilpnndrhqitdttnghyapvtyiqveatgtfiasgvvvgkdtlltnkhvvdathgdph alkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnna etqvnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknevi gihwggvpnefngavfinenvrnflkqniedinfa
Timeline for d1wcza_: