Lineage for d1wcza_ (1wcz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794781Protein V8 protease [101809] (1 species)
    glutamic acid-specific protease
  7. 2794782Species Staphylococcus aureus [TaxId:1280] [101810] (3 PDB entries)
    Uniprot P04188 69-284
  8. 2794785Domain d1wcza_: 1wcz A: [109229]
    complexed with zn

Details for d1wcza_

PDB Entry: 1wcz (more details), 2 Å

PDB Description: Crystal structure of an alkaline form of v8 protease from Staphylococcus aureus
PDB Compounds: (A:) Glutamyl endopeptidase

SCOPe Domain Sequences for d1wcza_:

Sequence, based on SEQRES records: (download)

>d1wcza_ b.47.1.1 (A:) V8 protease {Staphylococcus aureus [TaxId: 1280]}
vilpnndrhqitdttnghyapvtyiqveaptgtfiasgvvvgkdtlltnkhvvdathgdp
halkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnn
aetqvnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknev
igihwggvpnefngavfinenvrnflkqniedinfa

Sequence, based on observed residues (ATOM records): (download)

>d1wcza_ b.47.1.1 (A:) V8 protease {Staphylococcus aureus [TaxId: 1280]}
vilpnndrhqitdttnghyapvtyiqveatgtfiasgvvvgkdtlltnkhvvdathgdph
alkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnna
etqvnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknevi
gihwggvpnefngavfinenvrnflkqniedinfa

SCOPe Domain Coordinates for d1wcza_:

Click to download the PDB-style file with coordinates for d1wcza_.
(The format of our PDB-style files is described here.)

Timeline for d1wcza_: