Lineage for d1w7la_ (1w7l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131269Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species)
  7. 2131270Species Human (Homo sapiens) [TaxId:9606] [110682] (3 PDB entries)
    Uniprot Q16773
  8. 2131271Domain d1w7la_: 1w7l A: [109226]
    complexed with plp

Details for d1w7la_

PDB Entry: 1w7l (more details), 2 Å

PDB Description: crystal structure of human kynurenine aminotransferase i
PDB Compounds: (A:) kynurenine--oxoglutarate transaminase I

SCOPe Domain Sequences for d1w7la_:

Sequence, based on SEQRES records: (download)

>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]}
qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
ffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvlntp
nnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltig
sagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqps
syfvqfpqamqrcrdhmirslqsvglkplipqgsyflitdisdfkrkmpdlpgavdepyd
rrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkve

Sequence, based on observed residues (ATOM records): (download)

>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]}
qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
ffdcyepmtmmaggrpvfvslkpgpgelgsssnwqldpmelagkftsrtkalvlntpnnp
lgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltigsag
ktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqpssyf
vqfpqamqrcrdhmirslqsvglkplipqgsyflitdisdfkrkmpdlpgavdepydrrf
vkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkve

SCOPe Domain Coordinates for d1w7la_:

Click to download the PDB-style file with coordinates for d1w7la_.
(The format of our PDB-style files is described here.)

Timeline for d1w7la_: