Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) automatically mapped to Pfam PF01624 |
Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
Protein DNA repair protein MutS, domain I [55273] (2 species) |
Species Escherichia coli [TaxId:562] [55275] (8 PDB entries) Uniprot P23909 2-800 |
Domain d1w7ab4: 1w7a B:14-116 [109225] Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa3, d1w7ab1, d1w7ab2, d1w7ab3 complexed with atp, mg |
PDB Entry: 1w7a (more details), 2.27 Å
SCOPe Domain Sequences for d1w7ab4:
Sequence, based on SEQRES records: (download)
>d1w7ab4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]} mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
>d1w7ab4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]} mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl vnqgesvaicerkvvrivtp
Timeline for d1w7ab4:
View in 3D Domains from other chains: (mouse over for more information) d1w7aa1, d1w7aa2, d1w7aa3, d1w7aa4 |