Lineage for d1w7ab3 (1w7a B:117-269)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488858Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 488859Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 488860Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 488861Species Escherichia coli [TaxId:562] [53154] (7 PDB entries)
  8. 488865Domain d1w7ab3: 1w7a B:117-269 [109224]
    Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa4, d1w7ab1, d1w7ab2, d1w7ab4

Details for d1w7ab3

PDB Entry: 1w7a (more details), 2.27 Å

PDB Description: atp bound muts

SCOP Domain Sequences for d1w7ab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7ab3 c.55.6.1 (B:117-269) DNA repair protein MutS, domain II {Escherichia coli}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOP Domain Coordinates for d1w7ab3:

Click to download the PDB-style file with coordinates for d1w7ab3.
(The format of our PDB-style files is described here.)

Timeline for d1w7ab3: