SCOPe 2.08: Domain d1w7ab2: 1w7a B:567-800

Lineage for d1w7ab2 (1w7a B:567-800)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)

7. Species Escherichia coli [TaxId:562] [52699] (8 PDB entries)
   Uniprot P23909 2-800

8. Domain d1w7ab2: 1w7a B:567-800 [109223]
   Other proteins in same PDB: d1w7aa1, d1w7aa3, d1w7aa4, d1w7ab1, d1w7ab3, d1w7ab4
   complexed with atp, mg

Details for d1w7ab2

PDB Entry: 1w7a, 2.27 Å

PDB Description: atp bound muts

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1w7ab2:

Sequence, based on SEQRES records:

>d1w7ab2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records):

>d1w7ab2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddsgrstfmvemtetanilhnateys
lvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhld
alehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Timeline for d1w7ab2:

• d1w7ab2 first appeared in SCOP 1.69
  
• d1w7ab2 appears in SCOPe 2.07