Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
Species Escherichia coli [TaxId:562] [52699] (8 PDB entries) Uniprot P23909 2-800 |
Domain d1w7ab2: 1w7a B:567-800 [109223] Other proteins in same PDB: d1w7aa1, d1w7aa3, d1w7aa4, d1w7ab1, d1w7ab3, d1w7ab4 complexed with atp, mg |
PDB Entry: 1w7a (more details), 2.27 Å
SCOPe Domain Sequences for d1w7ab2:
Sequence, based on SEQRES records: (download)
>d1w7ab2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
>d1w7ab2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgaaddsgrstfmvemtetanilhnateys lvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhld alehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
Timeline for d1w7ab2:
View in 3D Domains from other chains: (mouse over for more information) d1w7aa1, d1w7aa2, d1w7aa3, d1w7aa4 |