| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) ![]() |
| Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein) |
| Protein DNA repair protein MutS, domain III [48336] (2 species) |
| Species Escherichia coli [TaxId:562] [48338] (8 PDB entries) Uniprot P23909 2-800 |
| Domain d1w7ab1: 1w7a B:270-566 [109222] Other proteins in same PDB: d1w7aa2, d1w7aa3, d1w7aa4, d1w7ab2, d1w7ab3, d1w7ab4 complexed with atp, mg |
PDB Entry: 1w7a (more details), 2.27 Å
SCOPe Domain Sequences for d1w7ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7ab1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1w7ab1:
View in 3DDomains from other chains: (mouse over for more information) d1w7aa1, d1w7aa2, d1w7aa3, d1w7aa4 |