Lineage for d1w7aa3 (1w7a A:117-269)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2140751Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) (S)
  5. 2140752Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 2140753Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 2140754Species Escherichia coli [TaxId:562] [53154] (8 PDB entries)
    Uniprot P23909 2-800
  8. 2140756Domain d1w7aa3: 1w7a A:117-269 [109220]
    Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa4, d1w7ab1, d1w7ab2, d1w7ab4
    complexed with atp, mg

Details for d1w7aa3

PDB Entry: 1w7a (more details), 2.27 Å

PDB Description: atp bound muts
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1w7aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7aa3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOPe Domain Coordinates for d1w7aa3:

Click to download the PDB-style file with coordinates for d1w7aa3.
(The format of our PDB-style files is described here.)

Timeline for d1w7aa3: