SCOP 1.69: Domain d1w7aa3: 1w7a A:117-269

Lineage for d1w7aa3 (1w7a A:117-269)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family)

5. Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)

6. Protein DNA repair protein MutS, domain II [53152] (2 species)

7. Species Escherichia coli [TaxId:562] [53154] (7 PDB entries)

8. Domain d1w7aa3: 1w7a A:117-269 [109220]
   Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa4, d1w7ab1, d1w7ab2, d1w7ab4

Details for d1w7aa3

PDB Entry: 1w7a, 2.27 Å

PDB Description: atp bound muts

SCOP Domain Sequences for d1w7aa3:

Sequence; same for both SEQRES and ATOM records:

>d1w7aa3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

Timeline for d1w7aa3:

• d1w7aa3 is new in SCOP 1.69
  
• d1w7aa3 appears in SCOP 1.71
  
• d1w7aa3 appears in the current release, SCOPe 2.08