SCOPe 2.05: Domain d1w69a_: 1w69 A:

Lineage for d1w69a_ (1w69 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries)
   Uniprot P11157

8. Domain d1w69a_: 1w69 A: [109217]
   complexed with acy, fe2

Details for d1w69a_

PDB Entry: 1w69, 2.2 Å

PDB Description: crystal structure of mouse ribonucleotide reductase subunit r2 under reducing conditions. a fully occupied dinuclear iron cluster and bound acetate.

PDB Compounds: (A:) ribonucleoside-diphosphate reductase m2 chain

SCOPe Domain Sequences for d1w69a_:

Sequence; same for both SEQRES and ATOM records:

>d1w69a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]}
vedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpderhf
ishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidtyikd
pkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwl
kkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqeflte
alpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpf

Timeline for d1w69a_:

• d1w69a_ first appeared in SCOP 1.69
  
• d1w69a_ appears in SCOPe 2.04
  
• d1w69a_ appears in SCOPe 2.06
  
• d1w69a_ appears in the current release, SCOPe 2.08