Lineage for d1w69a_ (1w69 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703463Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2703551Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries)
    Uniprot P11157
  8. 2703556Domain d1w69a_: 1w69 A: [109217]
    complexed with acy, fe2

Details for d1w69a_

PDB Entry: 1w69 (more details), 2.2 Å

PDB Description: crystal structure of mouse ribonucleotide reductase subunit r2 under reducing conditions. a fully occupied dinuclear iron cluster and bound acetate.
PDB Compounds: (A:) ribonucleoside-diphosphate reductase m2 chain

SCOPe Domain Sequences for d1w69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w69a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]}
vedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpderhf
ishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidtyikd
pkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwl
kkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqeflte
alpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpf

SCOPe Domain Coordinates for d1w69a_:

Click to download the PDB-style file with coordinates for d1w69a_.
(The format of our PDB-style files is described here.)

Timeline for d1w69a_: