Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Ribonucleotide reductase R2 [47257] (10 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries) Uniprot P11157 |
Domain d1w69a_: 1w69 A: [109217] complexed with acy, fe2 |
PDB Entry: 1w69 (more details), 2.2 Å
SCOPe Domain Sequences for d1w69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w69a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]} vedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpderhf ishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidtyikd pkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwl kkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqeflte alpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpf
Timeline for d1w69a_: