Lineage for d1w63q_ (1w63 Q:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2650135Fold i.23: clathrin assemblies [111484] (1 superfamily)
  4. 2650136Superfamily i.23.1: clathrin assemblies [111485] (1 family) (S)
  5. 2650137Family i.23.1.1: clathrin assemblies [111486] (2 proteins)
  6. 2650138Protein AP1 clathrin adaptor core [111487] (1 species)
  7. 2650139Species Mouse (Mus musculus) [TaxId:10090] [111488] (1 PDB entry)
  8. 2650156Domain d1w63q_: 1w63 Q: [109208]

Details for d1w63q_

PDB Entry: 1w63 (more details), 4 Å

PDB Description: ap1 clathrin adaptor core
PDB Compounds: (Q:) adapter-related protein complex 1 sigma 1a subunit

SCOPe Domain Sequences for d1w63q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w63q_ i.23.1.1 (Q:) AP1 clathrin adaptor core {Mouse (Mus musculus) [TaxId: 10090]}
mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
gdvqdtskksvlkaieqadllqeedespr

SCOPe Domain Coordinates for d1w63q_:

Click to download the PDB-style file with coordinates for d1w63q_.
(The format of our PDB-style files is described here.)

Timeline for d1w63q_: