Lineage for d1w50a_ (1w50 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 804499Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 804554Protein beta-secretase (memapsin) [50671] (1 species)
  7. 804555Species Human (Homo sapiens) [TaxId:9606] [50672] (51 PDB entries)
    Uniprot P56817 58-446
    Uniprot P56817 60-447
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 804588Domain d1w50a_: 1w50 A: [109173]
    complexed with iod; mutant

Details for d1w50a_

PDB Entry: 1w50 (more details), 1.75 Å

PDB Description: apo structure of bace (beta secretase)
PDB Compounds: (A:) Beta-secretase 1

SCOP Domain Sequences for d1w50a_:

Sequence, based on SEQRES records: (download)

>d1w50a_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyni

Sequence, based on observed residues (ATOM records): (download)

>d1w50a_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgaasvggsmiiggidhslytgsl
wytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksi
kaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrp
vedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrta
avegpfvtldmedcgyni

SCOP Domain Coordinates for d1w50a_:

Click to download the PDB-style file with coordinates for d1w50a_.
(The format of our PDB-style files is described here.)

Timeline for d1w50a_: