Lineage for d1w4xa2 (1w4x A:155-389)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meanderSuperfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (13 proteins)
duplication: both domains have similar folds and functions
most members of the family contain common C-terminal alpha+beta domain
Protein Phenylacetone monooxygenase [110440] (1 species) Species Thermobifida fusca [TaxId:2021] [110441] (1 PDB entry) 
Domain d1w4xa2: 1w4x A:155-389 [109172]
Details for d1w4xa2
PDB Entry: 1w4x (more details), 1.7 Å
PDB Description: phenylacetone monooxygenase, a baeyer-villiger monooxygenase
SCOP Domain Sequences for d1w4xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca}
vpqlpnfpglkdfagnlyhtgnwphepvdfsgqrvgvigtgssgiqvspqiakqaaelfv
fqrtphfavparnapldpefladlkkryaefreesrntpggthryqgpksalevsdeelv
etlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfg
tkrlileidyyemfnrdnvhlvdtlsapietitprgvrtsereyeldslvlatgf
SCOP Domain Coordinates for d1w4xa2:
Click to download the PDB-style file with coordinates for d1w4xa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w4xa2:
- d1w4xa2 is new in SCOP 1.69
- d1w4xa2 appears in SCOP 1.71
- d1w4xa2 appears in the current release, SCOPe 2.08
View in 3D
