Lineage for d1w4xa1 (1w4x A:10-154,A:390-542)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 478897Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 478898Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 479223Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (13 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 479392Protein Phenylacetone monooxygenase [110440] (1 species)
  7. 479393Species Thermobifida fusca [TaxId:2021] [110441] (1 PDB entry)
  8. 479394Domain d1w4xa1: 1w4x A:10-154,A:390-542 [109171]

Details for d1w4xa1

PDB Entry: 1w4x (more details), 1.7 Å

PDB Description: phenylacetone monooxygenase, a baeyer-villiger monooxygenase

SCOP Domain Sequences for d1w4xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca}
rrqppeevdvlvvgagfsglyalyrlrelgrsvhvietagdvggvwywnrypgarcdies
ieycysfseevlqewnwteryasqpeilryinfvadkfdlrsgitfhttvtaaafdeatn
twtvdtnhgdrirarylimasgqlsXdaltgalfkidirgvgnvalkekwaagprtylgl
stagfpnlffiagpgspsalsnmlvsieqhvewvtdhiaymfkngltrseavlekedewv
ehvneiadetlypmtaswytganvpgkprvfmlyvggfhryrqicdevaakgyegfvlt

SCOP Domain Coordinates for d1w4xa1:

Click to download the PDB-style file with coordinates for d1w4xa1.
(The format of our PDB-style files is described here.)

Timeline for d1w4xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w4xa2