Lineage for d1w3ya1 (1w3y A:170-540)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446542Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 446682Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 446688Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 446706Protein Hyaluronate lyase [48237] (2 species)
  7. 446711Species Streptococcus pneumoniae [TaxId:1313] [48238] (15 PDB entries)
  8. 446718Domain d1w3ya1: 1w3y A:170-540 [109168]
    Other proteins in same PDB: d1w3ya2, d1w3ya3

Details for d1w3ya1

PDB Entry: 1w3y (more details), 1.65 Å

PDB Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin c
PDB Compounds: (A:)

SCOP Domain Sequences for d1w3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ya1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOP Domain Coordinates for d1w3ya1:

Click to download the PDB-style file with coordinates for d1w3ya1.
(The format of our PDB-style files is described here.)

Timeline for d1w3ya1: