Lineage for d1w3td_ (1w3t D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834404Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species)
  7. 2834405Species Sulfolobus solfataricus [TaxId:2287] [110361] (5 PDB entries)
    Uniprot Q97U28
  8. 2834417Domain d1w3td_: 1w3t D: [109167]
    complexed with 3gr, gol, pyr, rsh
    has additional insertions and/or extensions that are not grouped together

Details for d1w3td_

PDB Entry: 1w3t (more details), 2.1 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with d-kdgal, d-glyceraldehyde and pyruvate
PDB Compounds: (D:) 2-keto-3-deoxy gluconate aldolase

SCOPe Domain Sequences for d1w3td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3td_ c.1.10.1 (D:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOPe Domain Coordinates for d1w3td_:

Click to download the PDB-style file with coordinates for d1w3td_.
(The format of our PDB-style files is described here.)

Timeline for d1w3td_: