SCOPe 2.08: Domain d1w3ta_: 1w3t A:

Lineage for d1w3ta_ (1w3t A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [110361] (5 PDB entries)
   Uniprot Q97U28

8. Domain d1w3ta_: 1w3t A: [109164]
   complexed with 3gr, gol, pyr, rsh
   has additional insertions and/or extensions that are not grouped together

Details for d1w3ta_

PDB Entry: 1w3t, 2.1 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with d-kdgal, d-glyceraldehyde and pyruvate

PDB Compounds: (A:) 2-keto-3-deoxy gluconate aldolase

SCOPe Domain Sequences for d1w3ta_:

Sequence; same for both SEQRES and ATOM records:

>d1w3ta_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

Timeline for d1w3ta_:

• d1w3ta_ first appeared in SCOP 1.69
  
• d1w3ta_ appears in SCOPe 2.07