Lineage for d1w3la_ (1w3l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830914Protein Endoglucanase Cel5a [51499] (4 species)
  7. 2830915Species Bacillus agaradhaerens [TaxId:76935] [51500] (21 PDB entries)
    Uniprot O85465 30-329
  8. 2830920Domain d1w3la_: 1w3l A: [109159]
    complexed with gol, oxz, so4

Details for d1w3la_

PDB Entry: 1w3l (more details), 1.04 Å

PDB Description: endoglucanase cel5a from bacillus agaradhaerens in complex with cellotri derived-tetrahydrooxazine
PDB Compounds: (A:) endoglucanase 5a

SCOPe Domain Sequences for d1w3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3la_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOPe Domain Coordinates for d1w3la_:

Click to download the PDB-style file with coordinates for d1w3la_.
(The format of our PDB-style files is described here.)

Timeline for d1w3la_: