Lineage for d1w3jb_ (1w3j B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474776Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 474786Protein Beta-glucosidase A [51528] (6 species)
  7. 474823Species Thermotoga maritima [TaxId:243274] [89475] (5 PDB entries)
  8. 474827Domain d1w3jb_: 1w3j B: [109157]

Details for d1w3jb_

PDB Entry: 1w3j (more details), 2 Å

PDB Description: family 1 b-glucosidase from thermotoga maritima in complex with tetrahydrooxazine

SCOP Domain Sequences for d1w3jb_:

Sequence, based on SEQRES records: (download)

>d1w3jb_ c.1.8.4 (B:) Beta-glucosidase A {Thermotoga maritima}
nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
pgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrf
mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk
fdpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvs
edgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdy
stqkrivkdsgywysnvvknngl

Sequence, based on observed residues (ATOM records): (download)

>d1w3jb_ c.1.8.4 (B:) Beta-glucosidase A {Thermotoga maritima}
nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
pgmrdiyvafravhnllraharavkvfretvdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
qkrivkdsgywysnvvknngl

SCOP Domain Coordinates for d1w3jb_:

Click to download the PDB-style file with coordinates for d1w3jb_.
(The format of our PDB-style files is described here.)

Timeline for d1w3jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w3ja_