Lineage for d1w3ja_ (1w3j A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683071Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (5 proteins)
  6. 683081Protein Beta-glucosidase A [51528] (7 species)
  7. 683121Species Thermotoga maritima [TaxId:2336] [89475] (22 PDB entries)
  8. 683148Domain d1w3ja_: 1w3j A: [109156]

Details for d1w3ja_

PDB Entry: 1w3j (more details), 2 Å

PDB Description: family 1 b-glucosidase from thermotoga maritima in complex with tetrahydrooxazine
PDB Compounds: (A:) Beta-glucosidase

SCOP Domain Sequences for d1w3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ja_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
kkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwke
dieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhwd
lpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhapg
mrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfmh
qfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfd
pdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
qkrivkdsgywysnvvknngled

SCOP Domain Coordinates for d1w3ja_:

Click to download the PDB-style file with coordinates for d1w3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1w3ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w3jb_