Lineage for d1w3bb_ (1w3b B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746069Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1746070Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1746117Protein O-GlcNAc transferase, OGT [109973] (2 species)
  7. 1746118Species Human (Homo sapiens) [TaxId:9606] [109974] (1 PDB entry)
    Uniprot O15294 16-400
  8. 1746120Domain d1w3bb_: 1w3b B: [109150]
    complexed with ca

Details for d1w3bb_

PDB Entry: 1w3b (more details), 2.85 Å

PDB Description: the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha.
PDB Compounds: (B:) udp-n-acetylglucosamine--peptide n-acetylglucosaminyltransferase 110

SCOPe Domain Sequences for d1w3bb_:

Sequence, based on SEQRES records: (download)

>d1w3bb_ a.118.8.1 (B:) O-GlcNAc transferase, OGT {Human (Homo sapiens) [TaxId: 9606]}
gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
cpthadslnnlanikreqgnieeavrlyrkalevfpefaaahsnlasvlqqqgklqealm
hykeairisptfadaysnmgntlkemqd

Sequence, based on observed residues (ATOM records): (download)

>d1w3bb_ a.118.8.1 (B:) O-GlcNAc transferase, OGT {Human (Homo sapiens) [TaxId: 9606]}
gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
cpthadsyrkalevfpefaaahsnlasvlqqqgklqealmhykeairisptfadaysnmg
ntlkemqd

SCOPe Domain Coordinates for d1w3bb_:

Click to download the PDB-style file with coordinates for d1w3bb_.
(The format of our PDB-style files is described here.)

Timeline for d1w3bb_: