Lineage for d1w39c_ (1w39 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087085Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins)
    automatically mapped to Pfam PF00983
  6. 2087086Protein Tymovirus coat protein [88642] (3 species)
  7. 2087098Species TYMV (Turnip yellow mosaic virus) [TaxId:12154] [49640] (2 PDB entries)
    Uniprot P03608
  8. 2087104Domain d1w39c_: 1w39 C: [109148]

Details for d1w39c_

PDB Entry: 1w39 (more details), 3.75 Å

PDB Description: crystal structure of an artificial top component of turnip yellow mosaic virus
PDB Compounds: (C:) turnip yellow mosaic virus empty capsid

SCOPe Domain Sequences for d1w39c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w39c_ b.121.4.6 (C:) Tymovirus coat protein {TYMV (Turnip yellow mosaic virus) [TaxId: 12154]}
meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
splitdtst

SCOPe Domain Coordinates for d1w39c_:

Click to download the PDB-style file with coordinates for d1w39c_.
(The format of our PDB-style files is described here.)

Timeline for d1w39c_: