| Class b: All beta proteins [48724] (178 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins) automatically mapped to Pfam PF00983 |
| Protein Tymovirus coat protein [88642] (3 species) |
| Species TYMV (Turnip yellow mosaic virus) [TaxId:12154] [49640] (2 PDB entries) Uniprot P03608 |
| Domain d1w39b_: 1w39 B: [109147] |
PDB Entry: 1w39 (more details), 3.75 Å
SCOPe Domain Sequences for d1w39b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w39b_ b.121.4.6 (B:) Tymovirus coat protein {TYMV (Turnip yellow mosaic virus) [TaxId: 12154]}
meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
splitdtst
Timeline for d1w39b_: