![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (6 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [110361] (4 PDB entries) |
![]() | Domain d1w37d_: 1w37 D: [109145] |
PDB Entry: 1w37 (more details), 2 Å
SCOP Domain Sequences for d1w37d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w37d_ c.1.10.1 (D:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus} peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
Timeline for d1w37d_: