Lineage for d1w37b_ (1w37 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821673Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species)
  7. 1821674Species Sulfolobus solfataricus [TaxId:2287] [110361] (4 PDB entries)
    Uniprot Q97U28
  8. 1821680Domain d1w37b_: 1w37 B: [109143]
    complexed with gol, na

Details for d1w37b_

PDB Entry: 1w37 (more details), 2 Å

PDB Description: 2-keto-3-deoxygluconate(kdg) aldolase of sulfolobus solfataricus
PDB Compounds: (B:) 2-keto-3-deoxy gluconate aldolase

SCOPe Domain Sequences for d1w37b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w37b_ c.1.10.1 (B:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOPe Domain Coordinates for d1w37b_:

Click to download the PDB-style file with coordinates for d1w37b_.
(The format of our PDB-style files is described here.)

Timeline for d1w37b_: