![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [110361] (5 PDB entries) Uniprot Q97U28 |
![]() | Domain d1w37b_: 1w37 B: [109143] complexed with gol, na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1w37 (more details), 2 Å
SCOPe Domain Sequences for d1w37b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w37b_ c.1.10.1 (B:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
Timeline for d1w37b_: