Lineage for d1w2xb2 (1w2x B:1815-2189)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480393Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 480394Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 480567Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (3 proteins)
    the active site is formed by two different homologous subunits or domains of this fold
  6. 480568Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 480569Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (7 PDB entries)
  8. 480589Domain d1w2xb2: 1w2x B:1815-2189 [109137]

Details for d1w2xb2

PDB Entry: 1w2x (more details), 2.8 Å

PDB Description: crystal structure of the carboxyltransferase domain of acetyl-coenzyme a carboxylase in complex with cp-640186

SCOP Domain Sequences for d1w2xb2:

Sequence, based on SEQRES records: (download)

>d1w2xb2 c.14.1.4 (B:1815-2189) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkgl

Sequence, based on observed residues (ATOM records): (download)

>d1w2xb2 c.14.1.4 (B:1815-2189) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlellpiyg
qislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeas
rlekiarirswypasvdheddrqvatwieenyktlddklkgl

SCOP Domain Coordinates for d1w2xb2:

Click to download the PDB-style file with coordinates for d1w2xb2.
(The format of our PDB-style files is described here.)

Timeline for d1w2xb2: