Lineage for d1w2w.3 (1w2w I:,J:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151171Family c.124.1.5: IF2B-like [110513] (5 protein domains)
    Pfam PF01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 2151192Protein Putative methylthioribose-1-phosphate isomerase Ypr118W [110516] (1 species)
  7. 2151193Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110517] (1 PDB entry)
    Uniprot Q06489
  8. 2151196Domain d1w2w.3: 1w2w I:,J: [109132]
    complexed with so4

Details for d1w2w.3

PDB Entry: 1w2w (more details), 1.75 Å

PDB Description: crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits
PDB Compounds: (I:) 5-methylthioribose-1-phosphate isomerase, (J:) 5-methylthioribose-1-phosphate isomerase

SCOPe Domain Sequences for d1w2w.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1w2w.3 c.124.1.5 (I:,J:) Putative methylthioribose-1-phosphate isomerase Ypr118W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msleaivfdrsepenvsvkvldqlllpyttkyvpihtiddgysviksmqvrgapaiaivg
slsvltevqlikhnptsdvatlyslvnwestktvlnkrldfllssrptavnlsnslveik
nilksssdlkafdgslynyvcelidedlannmkmgdngakylidvlqkdgfkdefavlti
cntgslatsgygtalgvirslwkdslaktdkXcprmghvfpletrpynqgsrltayelvy
dkipstlitdssiayrirtspipikaafvgadrivrngdtankigtlqlavickqfgikf
fvvapkttidnvtetgddiiveernpeefkvvtgtvinpengslilnesgepitgkvgia
pleinvwnpafditphelidgiiteegvftknssgefqleslf

SCOPe Domain Coordinates for d1w2w.3:

Click to download the PDB-style file with coordinates for d1w2w.3.
(The format of our PDB-style files is described here.)

Timeline for d1w2w.3: